DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH5

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001097988.2 Gene:CAH5 / 50102 FlyBaseID:FBgn0040629 Length:302 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:135/270 - (50%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GRHGPEHWSEDY-ARC-SGKHQSPINI----DQVSAVEKKFPKLEFFNF-KVVPDNLQMTNNGHT 89
            |.:..:...:|: ..| ||::||||::    .::.|:    |:|.|.|: :.:...|.:||||||
  Fly    41 GEYNYDEQGDDWTGTCQSGENQSPIDLIFEDSKIVAI----PRLRFNNYDQPLQTPLVITNNGHT 101

  Fly    90 V-LVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN 153
            . :|.......:.||:.|..|    |..::.:..|||||..:..|||..||.:.|..|:|:|.:|
  Fly   102 ANMVIPQTRGGQRPSINGSLL----PGNFEAQSVHFHWGSREAKGSEHAINFQRYDVEMHIVHKN 162

  Fly   154 LEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDR---KGKSVNMTNPLPLGEYI 215
            ..|.....|.....|:||:...|:..|:.|..:.|...:.:|:.|   ...:..:|..|.:|:.:
  Fly   163 TIYETMGEATMHPDGLAVLGVMFRAVDRQTSQHYGLNKIFNQLPRIVQYNSNATITGRLTVGQLL 227

  Fly   216 SKSVE-SYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQL-NAFRLLTANDDHLKNNFRPIQPLN 278
            ...|. .:|:|.||||||.|:|.|||..|...:|...:|: ..:.|..:....|.||:|.||..|
  Fly   228 GNIVTGEFFTYNGSLTTPDCAEAVTWTVFPDVLDYPRRQITKLWNLRDSRQRPLINNYRSIQDTN 292

  Fly   279 DRTLYKNYIE 288
            .|.:|...|:
  Fly   293 SRDVYYRTIQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 81/261 (31%)
CAH5NP_001097988.2 Carb_anhydrase 43..294 CDD:215000 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27166
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.880

Return to query results.
Submit another query.