DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Ca13

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:267 Identity:99/267 - (37%)
Similarity:140/267 - (52%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKF-PKLEFFNFKVVPDNLQ-MTNNGHTV 90
            :||:..:||.||:|.:....|..||||   ::...|.|: ..|...:.|..|.:.: ::|:||:.
  Rat     6 WGYDEHNGPIHWNELFPIADGDQQSPI---EIKTKEVKYDSSLRPLSIKYDPASAKIISNSGHSF 67

  Fly    91 LVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE 155
            .|.....||: ..:|||||..    .|:..|||.|||..|..|||.:::...|.||||||..|.:
  Rat    68 NVDFDDTEDK-SVLRGGPLTG----SYRLRQFHLHWGSADDHGSEHVVDGVRYAAELHVVHWNSD 127

  Fly   156 -YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSV 219
             ||.|..|..:..|:||:..|.|:|:.:. ..:..|::|..|..|||....||..||  .:..|.
  Rat   128 KYPSFVEAAHESDGLAVLGVFLQIGEHNP-QLQKITDILDSIKEKGKQTRFTNFDPL--CLLPSS 189

  Fly   220 ESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR--LLTANDD---HLKNNFRPIQPLND 279
            ..|::|.||||.||..|.||||....||.|:.:||..||  |.||..:   .|.:|.||.|||..
  Rat   190 WDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAAFLLSNHRPPQPLKG 254

  Fly   280 RTLYKNY 286
            |.:..::
  Rat   255 RRVRASF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 98/260 (38%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 99/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.