DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH6

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:283 Identity:92/283 - (32%)
Similarity:144/283 - (50%) Gaps:28/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LVLAQDFGYE---GRHGPE-HWSEDYAR--------CS-GKHQSPINIDQVSAVEKKFPKLEFFN 73
            |:|.....|:   ..|..| ||  ||..        || |:.||||:::...::....|::.|.|
  Fly     9 LLLLLPLAYQHTSNDHKDESHW--DYETNGQNWGGICSTGERQSPISLNVQKSLIVPLPRIVFGN 71

  Fly    74 FKV-VPDNLQMTNNGHTVLVKM--SYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSE 135
            :.| :...|.:.|||||..|::  :.|.:: |.:.||.|..:    :..|.||||||...:.|||
  Fly    72 YDVKLRGPLTLLNNGHTAHVEIPETANGNK-PFITGGLLKGR----FVAEAFHFHWGSPSSRGSE 131

  Fly   136 DLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKG 200
            ..||.:.:..|:|:|.||.:|.|...|.:|..||||:....::.......:.|.:.::|.:.|..
  Fly   132 HSINQQRFDVEMHIVHRNEKYGDIDEAKNKKDGIAVIGVMLKIVKNPNRIFPGLSKVMSALPRVT 196

  Fly   201 K-SVNMTNP--LPLGEYISK-SVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLT 261
            | :...|.|  |.||:.:.. :...:|:|.||||||.|.:.|||..|:..:.:....::.|..|.
  Fly   197 KYNAKTTIPGGLSLGQMLGNVNPRDFFTYRGSLTTPLCEQSVTWTVFSQVLPVPYSSVSKFWKLR 261

  Fly   262 ANDDH-LKNNFRPIQPLNDRTLY 283
            .::.| |.||||.|||.|.|.::
  Fly   262 DSEGHRLINNFRDIQPRNGRPVF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 89/273 (33%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 85/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.870

Return to query results.
Submit another query.