DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH4

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster


Alignment Length:265 Identity:82/265 - (30%)
Similarity:138/265 - (52%) Gaps:14/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNF-KVVPDNLQMTNNGHTVL 91
            ||:........|:   .:| |:.||||.:...:|:....|||:|.|: |.:.|.|.:.|||.|||
  Fly    19 FGFNYDKQGRDWN---VKC-GERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVL 79

  Fly    92 VKMSYNED-EIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE 155
            :::....| ..||:   .::.:....::.:|.|||||...:.|||..::...|..|:|:|.:|..
  Fly    80 MRIPKTVDGSRPSL---CISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNAS 141

  Fly   156 YPDFASALDKDHGIAVMAFFFQ-VGDKS--TGGYEGFTNLLSQIDRKGKSVNMTNPLPLGE-YIS 216
            |.....|..:.:|.||:|.|.: :.|.:  |.........:|.|.:...|..:.:.:.|.: :.|
  Fly   142 YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFAS 206

  Fly   217 KSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAF-RLLTANDDHLKNNFRPIQPLNDR 280
            ...:.||:|.||||||||:|.|.|..|.||:|:.::....| :|..:.|..:.|.:|.:|..:||
  Fly   207 IDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDR 271

  Fly   281 TLYKN 285
            .:|::
  Fly   272 PVYRS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 80/259 (31%)
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
98.970

Return to query results.
Submit another query.