DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH8

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001262833.1 Gene:CAH8 / 42625 FlyBaseID:FBgn0038956 Length:303 Species:Drosophila melanogaster


Alignment Length:286 Identity:93/286 - (32%)
Similarity:134/286 - (46%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKL------EFFNFKVVPDNLQMTN 85
            ||.|:   .||.|.|.|..|.|..||||.|.:..|:....|.|      |||:     :.:.:.|
  Fly    27 DFDYK---SPERWPEKYPNCGGSEQSPIAISRRKAIPLNLPPLIFALYDEFFD-----ELVTIRN 83

  Fly    86 NGHTVLVKMSYNEDEI-PSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHV 149
            :||||..|:......: |.|.||.|.:    .|..|..|||||..::.|||.|:|.|.:..|:|:
  Fly    84 SGHTVEFKVPTTIYGVKPYVTGGLLRD----CYDAEAVHFHWGSPESKGSEHLLNGRRFDLEMHI 144

  Fly   150 VLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYE-GFTNLLSQIDRKGK---SVNMTNPLP 210
            |.||.:|.:...|:....|:.|:|..|:|.......|: |.:.:.|.:...|.   |..:...|.
  Fly   145 VHRNTKYLNLEEAVKYSDGVTVLAVLFKVVRSGPFFYQPGLSEIFSSLLHLGNFNASYTVQERLT 209

  Fly   211 LGEYI-SKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAF-RLLTANDDHLKNNFRP 273
            ||..: |....::::|.|||||||||..|.|..|...:.|:.:.|..| .|.......|..||||
  Fly   210 LGSLLGSLDRGNFYTYKGSLTTPPCSPVVQWHVFGEVLPISHQDLPKFWNLRDERGRPLLKNFRP 274

  Fly   274 IQPLNDRTLYKNYIEIPIHNMGSIPL 299
            :|...:|.::        |....:||
  Fly   275 LQSQENRLIF--------HRQHIVPL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 88/265 (33%)
CAH8NP_001262833.1 Carb_anhydrase 31..281 CDD:215000 86/261 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27166
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.880

Return to query results.
Submit another query.