DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH7

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster


Alignment Length:334 Identity:103/334 - (30%)
Similarity:163/334 - (48%) Gaps:62/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVIAPILICASLVL--AQDFGYEGRHGPE---HWSEDYAR----C-SGKHQSPINIDQVSAVEKK 65
            ::...:::|.|:..  |.::||     |:   :..|.:.:    | |||.|||||:....|::.:
  Fly     3 LIALSLIVCCSVSFSWANEWGY-----PDLDNNQDEPFPKWGGLCDSGKKQSPINLHVKGALKGE 62

  Fly    66 FPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGEND 130
            |..|:|.|:.....||:|.||||:  :::|..:.|: ::.||.|.:    .:..||.|.||    
  Fly    63 FDALKFENYDEHQKNLRMVNNGHS--IQLSGFDHEL-TLSGGALLQ----DFVVEQIHMHW---- 116

  Fly   131 TIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGD----------KSTGG 185
              .||..||:..||.|:|:|.||..||:...|.:...||.|:...:.|.:          ||.|.
  Fly   117 --WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSIIKSLGA 179

  Fly   186 YEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDIT 250
            .:.:       |...|.|.:.:.|.:.:.: .|||:||:|.||||||.|:|.||||..|....:|
  Fly   180 VKSY-------DSMNKPVLVADSLAVDDLV-PSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVT 236

  Fly   251 EKQLNAFRLLTAND-DHLKNNFRPIQPLNDRTLYKNYIEIPIHNMGSIPLVDAENAAGKWRAQAA 314
            ..|:|.|:.:..:: ..|.||:|.:|..|:|.:.  .:|.|....||..|             .|
  Fly   237 LDQVNEFKEIEYDEGKQLHNNYRELQSENNRAVV--LVEQPEQRSGSAGL-------------TA 286

  Fly   315 AVLLPLVVL 323
            :|.|.|:.|
  Fly   287 SVSLGLMTL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 89/271 (33%)
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27166
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.880

Return to query results.
Submit another query.