DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH15

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:141/292 - (48%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RRCRNTPFAIVIAPILICASLVLAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKF 66
            ||.|.:|                 :.:.|:...||..|.   ..|:  :||||||| ::.||..:
  Fly    73 RRLRGSP-----------------ESYNYDWDQGPHTWD---TACN--NQSPINID-MNCVEINY 114

  Fly    67 --PKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLG-YQFEQFHFHWGE 128
              ..|.:.::..:|..:::.|||||::::.::.| ..||:.||.|     || :.|.:..|.|..
  Fly   115 FDTPLIWSHYNSIPLGIRLENNGHTLILRAAFPE-RTPSIDGGDL-----LGRFDFREISFRWSW 173

  Fly   129 NDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLL 193
            ..::|||..:::...|.|:..:..:   .|.........|:.::::.|.:.:     :..|.::|
  Fly   174 ASSLGSEHTLDHHHSPLEMQCLHTD---GDGCDGCSSSQGVLMISYMFDLSE-----HNPFLDVL 230

  Fly   194 SQ----IDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQL 254
            .|    :::.|:.|.:. |.||...:|...:.::||.||||.|||.....|:.:...:.|:|:||
  Fly   231 IQHLAAVEQAGQVVEVP-PFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQL 294

  Fly   255 NAFR-LLTANDDHLKNNFRPIQPLNDRTLYKN 285
            |.|| |.......:..|.||:||:.||.:|.|
  Fly   295 NEFRQLRDRRGSRIARNARPVQPIGDRMVYLN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 73/260 (28%)
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27166
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.