DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH14

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster


Alignment Length:248 Identity:63/248 - (25%)
Similarity:105/248 - (42%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KHQSPINIDQVSAVEK--KFPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAE 111
            |..|||.|.:.:.:::  |.| |.:..::.:|....:.|||:||::::....:.:|.:.|..|  
  Fly    71 KQPSPITIPESNMIKRQLKMP-LHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAEL-- 132

  Fly   112 KTPLG-YQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLR------NLEYPDFASALDKDHGI 169
               || |||.:..|.||   ::.||..|....:..||..:.|      |.||             
  Fly   133 ---LGRYQFVEAIFKWG---SLKSEHSIGKHNFCLELQALHRCAQLNNNFEY------------- 178

  Fly   170 AVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPC 234
            ..:::.|.:........:..|:.|..|.:.|.|:.:. |..|...:......||||.|:......
  Fly   179 LTLSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELP-PFHLESLLQPFGSGYFSYEGTYDNGDV 242

  Fly   235 SEEVTWIDFTTPIDITE-KQLNAFRLLTA-NDDHLKNNFRPIQPLNDRTLYKN 285
            ....||: ....|.:.: :||:.|..|.. |.:....|.|..|||.:|.:|.|
  Fly   243 VLPTTWL-INRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVYFN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 60/242 (25%)
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.