DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Ca12

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:309 Identity:100/309 - (32%)
Similarity:156/309 - (50%) Gaps:30/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YEGRHGPEHWSEDYARCSGKHQSPINI-DQVSAVEKKFPKLEFFNFKV-VPDNLQMTNNGHTVLV 92
            |.|..|.::||:.|..|.|..||||:: ..:...:.....|:|..:.| |...|.:||:||:  |
  Rat    34 YIGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHS--V 96

  Fly    93 KMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWG-ENDTIGSEDLINNRAYPAELHVVLRNLE- 155
            :::.|.|..  ::|     ..|..|:.||.|.||| .||..|||..::.:.:.||||:|..|.: 
  Rat    97 RLNLNSDMY--IQG-----LQPHQYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDL 154

  Fly   156 YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVE 220
            |.||.||.||..|:||:|...::|..:. .|:...:.|..:..||:.| :.....:.|.:.:|..
  Rat   155 YSDFGSASDKSEGLAVLAVLIEIGSVNP-SYDKIFSHLQHVKYKGQQV-LIPGFNIEELLPESPG 217

  Fly   221 SYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR---LLTANDD----HLKNNFRPIQPLN 278
            .|:.|.||||||||...|.|..|..|:.|:::||.|..   ..|..||    .:.||||.:|..:
  Rat   218 EYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPSPREMVNNFRQVQKFD 282

  Fly   279 DRTLYKNYIEIPIHNMGSIPLVDAENAAGKWRAQAAAVLLPLVVLAALS 327
            :|.:|.::      ..|.  |.|...:.|...:.|.|.:|.:.::.|:|
  Rat   283 ERLVYISF------RQGL--LTDTGLSLGIILSVALAGVLGISIVLAVS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 89/261 (34%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 89/261 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.