DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH13

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:276 Identity:72/276 - (26%)
Similarity:133/276 - (48%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGYEGRHGPEHWSEDYARCSGK------HQSPINIDQVSAVEKKFPK--LEFFNFKVVPDNLQMT 84
            :||:.:|||..|.......|..      .|||:|||: |.:::...:  |.:.::..:|.::.:.
  Fly    83 YGYDMQHGPHTWLPKSRSSSSSVEEATFFQSPVNIDE-SQIQRMAIRELLSWNHYDDLPASITLE 146

  Fly    85 NNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHV 149
            |.|.|::::..:: ...|::.|..|.    ..|.|.:..||||..::.|||..||:|.:|.|:.|
  Fly   147 NTGQTLILRAQFH-GNAPTISGADLL----ASYTFLELRFHWGWCNSEGSEHTINHRKFPLEMQV 206

  Fly   150 VLRNLEYPDFASALDK----DHGIAVMAFFFQVGDKSTGGYEGFTNLLSQ----IDRKGKSVNMT 206
            :.:.      .|.:.:    .:.:.::.:.|::     ..:..|.:.|.|    :.:.||.|.: 
  Fly   207 MHKT------GSGIPRTCTSSYDLLMIGYVFEL-----SAHNPFLDPLVQNLRLVQKPGKRVQI- 259

  Fly   207 NPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND--DHLKN 269
            :|.|:...:.:....::||.||||.|||.:...|..|...:.|::.||..||||...|  ..:..
  Fly   260 SPFPISYLMYQFRSGFYSYGGSLTHPPCYQGTEWFIFPESLAISDFQLRHFRLLLGPDGISPIAR 324

  Fly   270 NFRPIQPLNDRTLYKN 285
            |.||:|.:.:|.:..|
  Fly   325 NSRPVQHMGNRVVSLN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 70/270 (26%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.