DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CAH1

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:274 Identity:98/274 - (35%)
Similarity:147/274 - (53%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEF--FNFKVVPDNLQ-MTN 85
            ::..:||...:||.||:::|.:.||..|||::|...||  ||..:|..  ..:|.||::.: :.|
  Fly     1 MSHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSA--KKGSELNVAPLKWKYVPEHTKSLVN 63

  Fly    86 NGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVV 150
            .|:...|.::..:.|:   .||||.::.   ::.||||.|||..|:.|||..::..:|..|||:|
  Fly    64 PGYCWRVDVNGADSEL---TGGPLGDQI---FKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLV 122

  Fly   151 LRN-LEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEY 214
            ..| .:|..|..|.....|:||:..|.:.|:.. ...:..|:||..:..||..|.:......|:.
  Fly   123 HWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHH-AELDKVTSLLQFVLHKGDRVTLPQGCDPGQL 186

  Fly   215 ISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND-----------DHLK 268
            : ..|.:|::|.||||||||||.|.||.|.|||::::.||||.|.|.|.|           ..:.
  Fly   187 L-PDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVI 250

  Fly   269 NNFRPIQPLNDRTL 282
            |||||..||..|.|
  Fly   251 NNFRPPLPLGKREL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 96/267 (36%)
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 96/267 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.870

Return to query results.
Submit another query.