DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CARPB

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster


Alignment Length:310 Identity:92/310 - (29%)
Similarity:152/310 - (49%) Gaps:62/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ICASLVLA------------QD-FGYEGRHGPEHW---SEDYARCS-GKHQSPINIDQVSAVEKK 65
            :|.:|:|.            :| :.|:|..||..|   :.:::.|: |:.|||:|::        
  Fly     7 LCCTLLLLLARMQVLLAVSWEDWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLE-------- 63

  Fly    66 FPKLEFFNFKVVPDNLQ-------MTNNGHTVL------VKMSYNEDEIP-SVRGGPLAEKTPLG 116
             |:...|:..:.|.::.       :||.||:|:      ...:|:..:.| ::.||||:.:    
  Fly    64 -PQRLLFDPNLRPMHIDKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYR---- 123

  Fly   117 YQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE-YPDFASALDKDHGIAVMAFFFQVGD 180
            |:|.:.|.|:|.||..|||..:....:|||:.:...|.: |.:|:.||::..||..::...|:||
  Fly   124 YRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGD 188

  Fly   181 KSTGGYEGFTNLLSQIDRKG-----KSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTW 240
            .|.......|:.|.:|...|     |.:::...||       ..:.|.:|.||.|.|.|.|.|||
  Fly   189 LSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLP-------DTDHYMTYDGSTTAPACHETVTW 246

  Fly   241 IDFTTPIDITEKQLNAF-RLLTANDDH----LKNNFRPIQPLNDRTLYKN 285
            :....||.||::||:|. ||:..:.||    |.||:||.|||..|.:..|
  Fly   247 VVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 86/281 (31%)
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 86/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.