DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Ca9

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:308 Identity:92/308 - (29%)
Similarity:148/308 - (48%) Gaps:45/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WSEDYARCSGKHQSPINID-QVSAVEKKFPKLEFFNFKV--VPDNLQMTNNGHTVLVKMSYNEDE 100
            |.:....|:|:.|||::|. ::::..:....||...:::  :|: |.:.||||||.:.:      
  Rat   128 WPQVSPACAGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPE-LSLCNNGHTVQLTL------ 185

  Fly   101 IPSVRGGPLAEKTPLG----YQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFAS 161
                   |...|..||    |:..|.|.|||.:|..|||..:|...:|||:|||..:..:.:...
  Rat   186 -------PPGLKMVLGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSELHE 243

  Fly   162 ALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYT 226
            ||.:..|:||:|.|.|...:....||...:.|.:|..:|..:.:.. |.:...:...:..|:.|.
  Rat   244 ALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKIEIPG-LDVSALLPSDLSRYYRYE 307

  Fly   227 GSLTTPPCSEEVTWIDFTTPIDITEKQLN--AFRLLTANDDHLKNNFRPIQPLNDRTLYKNYIEI 289
            |||||||||:.|.|..|...:.::.|||:  :..|....|..|:.|||..||||.||:..::..:
  Rat   308 GSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRLQLNFRATQPLNGRTIEASFPAV 372

  Fly   290 ------PIHNMGSIPLVDAENAAGKWRAQAAAVLLPLVVLAALSRTSI 331
                  |:|       |::..:||.        :|.||.....:.|||
  Rat   373 ADSSPEPVH-------VNSCLSAGD--------ILALVFGLLFAATSI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 79/250 (32%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.