DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Ca11

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_783639.1 Gene:Ca11 / 308588 RGDID:735155 Length:328 Species:Rattus norvegicus


Alignment Length:274 Identity:78/274 - (28%)
Similarity:125/274 - (45%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPEHW---SEDYARCS-GKHQSPINIDQVSAVEKKF-PKLEFFNFKVVPDNLQMT--NNG-HTVL 91
            ||..|   :..::.|: ||.|||::::....:...| |.|   ......:.|:.|  |.| |...
  Rat    48 GPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPL---RLSTGGEKLRGTLYNTGRHVSF 109

  Fly    92 VKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE- 155
            :..|   ..:.:|.||||.    ..::..:....:|..|..|||..||::.:.||:.::..|.| 
  Rat   110 LPAS---RPVVNVSGGPLL----YSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQEL 167

  Fly   156 YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTN--LLSQIDRKGK-------SVNMTNPLPL 211
            |.:.::|....:|:|:::.|..|...|........|  .:::|..|..       |:.:..|...
  Rat   168 YGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESF 232

  Fly   212 GEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND-----DHLKNNF 271
            |         :.:|.|||:||||||.||||.....::||..|:::.|||:.|.     ..|..|.
  Rat   233 G---------FITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNG 288

  Fly   272 RPIQPLNDRTLYKN 285
            ||:|||..|.|..|
  Rat   289 RPLQPLAHRALRGN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 75/268 (28%)
Ca11NP_783639.1 alpha_CARP_X_XI_like 48..304 CDD:239395 78/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.