DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Car14

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006501505.1 Gene:Car14 / 23831 MGIID:1344341 Length:460 Species:Mus musculus


Alignment Length:296 Identity:97/296 - (32%)
Similarity:149/296 - (50%) Gaps:25/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILICASLVLAQDFG----YEGRHGPEHWSEDYARCSGKHQSPINIDQVSAV-EKKFPKLEFFNF- 74
            :|:..:.:||.|.|    |||.||.:||...|..|.|..||||||...|.: :...|.::...: 
Mouse     6 LLLKVTWILAADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYD 70

  Fly    75 KVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTI-GSEDLI 138
            ::..:.|.:.||||||.:.:.      |::..|.|..|    |...|.|.|||:..:: |||..|
Mouse    71 QLGTEPLDLHNNGHTVQLSLP------PTLHLGGLPRK----YTAAQLHLHWGQRGSLEGSEHQI 125

  Fly   139 NNRAYPAELHVV-LRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKS 202
            |:.|..|||||| ..:..|...:.|..|..|:||:....:||:.....|:...:.|.:|..|.:.
Mouse   126 NSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQK 190

  Fly   203 VNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR--LLTANDD 265
            .::. |..:.|...:.:|.:|.|.||||||||.:.|.|..|.....|:..||...:  |.:..:|
Mouse   191 TSVP-PFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEED 254

  Fly   266 ---HLKNNFRPIQPLNDRTLYKNYIEI-PIHNMGSI 297
               .|..|:|..||||.||::.::|:. |::..|.:
Mouse   255 PSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 88/265 (33%)
Car14XP_006501505.1 alpha_CA_XII_XIV 29..278 CDD:239400 85/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5563
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.