DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and CA14

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_036245.1 Gene:CA14 / 23632 HGNCID:1372 Length:337 Species:Homo sapiens


Alignment Length:293 Identity:93/293 - (31%)
Similarity:144/293 - (49%) Gaps:28/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVIAPILICASLVLAQDFG----YEGRHGPEHWSEDYARCSGKHQSPINIDQVSAV-EKKFPKLE 70
            ::.:.:|:....:||.|.|    |||.||.:||...|..|....||||:|...|.. :...|.|:
Human     1 MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQ 65

  Fly    71 FFNF-KVVPDNLQMTNNGHTVLVKMSYNEDEIPSV--RGGPLAEKTPLGYQFEQFHFHWGENDTI 132
            ...: :...:.|.:.||||||.:       .:||.  .||     .|..|...|.|.|||:..:.
Human    66 PHGYDQPGTEPLDLHNNGHTVQL-------SLPSTLYLGG-----LPRKYVAAQLHLHWGQKGSP 118

  Fly   133 -GSEDLINNRAYPAELHVVLRNLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQ 195
             |||..||:.|..||||:|..:.: |...:.|.::..|:||:....:||:.....||...:.|.:
Human   119 GGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHE 183

  Fly   196 IDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR-- 258
            :..|.:..::. |..|.|.:.|.:..||.|.||||||||.:.|.|..|.....|:.:||...:  
Human   184 VRHKDQKTSVP-PFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGT 247

  Fly   259 LLTANDDHLK---NNFRPIQPLNDRTLYKNYIE 288
            |.:..::..|   .|:|.:||||.|.::.::|:
Human   248 LFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 87/267 (33%)
CA14NP_036245.1 alpha_CA_XII_XIV 29..278 CDD:239400 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5563
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.