DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and cah-6

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_491189.1 Gene:cah-6 / 189049 WormBaseID:WBGene00000284 Length:319 Species:Caenorhabditis elegans


Alignment Length:262 Identity:68/262 - (25%)
Similarity:108/262 - (41%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDN---LQMTNNGHTVLVKMSYNEDEIPSVRGGPL 109
            |:.||||:|  |..:......|:..:|:|..::   .:..|:|:::.:....|..|         
 Worm    65 GRTQSPIDI--VPVITAFGEHLQNAHFEVTYESTGEFKAVNDGNSIWLMREGNSSE--------- 118

  Fly   110 AEKTPLGYQF---EQFH-----FHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKD 166
                 |...|   ||:|     |||......|||..|....|..|:|::.||..:...|.||.:.
 Worm   119 -----LAISFLPEEQYHLDAVNFHWATEPMNGSEHTIGGVGYAGEMHLIHRNTRFATMADALKQP 178

  Fly   167 HGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGK-----SVNMTNPLPLGEYISKSVESYFSYT 226
            :|:..:|.|..........:....|||.|:..||.     |.:.....|:.|    ..:.::.|.
 Worm   179 NGVIAIAVFLNESHDDNAVFSPLINLLPQVIYKGSECKLCSFDFQTFFPVAE----KTKEFWMYE 239

  Fly   227 GSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAN--DDHLKNN-----FRPIQPLNDRTLYK 284
            ||.||.|..|.|.||.....:.|:..||:..|.:.|.  |:...:.     .||||..:.||:..
 Worm   240 GSETTDPFRETVNWIVIRAALPISSHQLDKLREVRAGRYDEEFSDKVPMKPLRPIQNPSSRTIQS 304

  Fly   285 NY 286
            ::
 Worm   305 SF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 66/255 (26%)
cah-6NP_491189.1 alpha_CARP_receptor_like 56..304 CDD:239396 68/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.