DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and cah-3

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001370788.1 Gene:cah-3 / 181713 WormBaseID:WBGene00000281 Length:246 Species:Caenorhabditis elegans


Alignment Length:257 Identity:97/257 - (37%)
Similarity:132/257 - (51%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPEHWSEDYARCSGKHQSPINIDQVSAVEKK--FPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYN 97
            ||..|.      :|:|||||||| :..||:|  ...::|.|:. .|....:.||||:|.:.... 
 Worm    14 GPNRWP------TGQHQSPINID-LGEVERKDTHDGIKFVNYD-HPIQGDIVNNGHSVQMTPEL- 69

  Fly    98 EDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASA 162
            ..|.|.:.||.|.:.    |:..|:||||||||..|||..:....||||||:|.:.:|.|.    
 Worm    70 RSEHPEIYGGGLDQV----YRLVQYHFHWGENDNEGSEHTLGGLRYPAELHLVHQGVEDPG---- 126

  Fly   163 LDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDR-KGK-----SVNMTNPLPLGEYISKSVES 221
                 .:||:..|.|:|.      ||  ..||..:| .||     :|.....:.|.|.:..:..|
 Worm   127 -----KLAVVGVFLQLGK------EG--KALSNEERVLGKLCNPETVTRVENVRLSEKLPANKRS 178

  Fly   222 YFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDH-LKNNFRPIQPLNDRTL 282
            ::.|.||||||||||.|||..||.|:.:|..||..||.:...:.. :|.|:||.|.||||.:
 Worm   179 FWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQVQDIEKRPIKKNYRPTQNLNDRKI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 96/254 (38%)
cah-3NP_001370788.1 Carb_anhydrase 5..239 CDD:215000 96/254 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I3023
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I3105
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.