DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and cah-5

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_509186.3 Gene:cah-5 / 180972 WormBaseID:WBGene00000283 Length:310 Species:Caenorhabditis elegans


Alignment Length:293 Identity:87/293 - (29%)
Similarity:142/293 - (48%) Gaps:36/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PFAIVIAPILICASLVLA------QDFGYEGRHGPEHWSEDYARCSGK-HQSPINIDQVSAVEKK 65
            |..:::..:|:...:|::      ..:||:..:||:.|.   .:|... .||||:|.........
 Worm     2 PSHLLVLSLLVALLVVVSCGPGSDHGWGYDENNGPDTWQ---GKCQNHLKQSPIDIRAPDVDYAL 63

  Fly    66 FPKLEFFNFKVVPDNLQMTNNGHTVLVK--MSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGE 128
            ..::.|.|:. :...::::|.|.|:...  .|:...: |.::||.|..:    |:..|||.|||:
 Worm    64 LHRMHFLNYD-MDGKIELSNTGRTLFAGGFESWQHKQ-PMIQGGGLKHR----YKLAQFHLHWGQ 122

  Fly   129 NDTIGSEDLINNRAYPAELHVV-LRNLEYPDFASALDKDHGIAVMAFFF-QVGDKSTGGYEGFTN 191
            ||.:|||..:.:..||||||:| :|  |......||.:..|:||:..|. :..|.....:...:.
 Worm   123 NDAVGSEHAMGSLHYPAELHLVHVR--EGLTLKEALSRPDGLAVVGVFLAKTNDPVANKFSPISE 185

  Fly   192 LLSQIDRKGKSVNMTN-----PLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITE 251
            .|..:...|....:.|     .|||      ..|:::.|.||||||.|||.|.|.....|:.|:.
 Worm   186 RLHDLRHSGNKTELKNFRTKYVLPL------DTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISS 244

  Fly   252 KQLNAFRLLTANDDHLKN--NFRPIQPLNDRTL 282
            .||:..|.| .|.:.:|:  |:||:||||.|.:
 Worm   245 HQLHLLRQL-HNKELVKSDKNYRPLQPLNGRRI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 83/264 (31%)
cah-5NP_509186.3 Carb_anhydrase 28..275 CDD:215000 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.