DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and cah-2

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_495567.3 Gene:cah-2 / 174218 WormBaseID:WBGene00000280 Length:337 Species:Caenorhabditis elegans


Alignment Length:284 Identity:77/284 - (27%)
Similarity:125/284 - (44%) Gaps:43/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPEHWS---EDYARC-SGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQ-------MTNNGH 88
            ||:.|.   .|:..| :|:.|||:|||         |....::..::|.|::       ..|.|.
 Worm    16 GPDFWGLLHGDWRMCTAGQMQSPVNID---------PSQLLYDPHLMPINIEGNIVEAVFENTGQ 71

  Fly    89 --TVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGEND--TIGSEDLINNRAYPAELHV 149
              .|.||...|...| ::.|||   ..|..|:..|...|:|..|  ..|||..::...:|||:.:
 Worm    72 LPVVTVKDLPNRPTI-NITGGP---TMPYRYKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQL 132

  Fly   150 VLRNLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGE 213
            :..|.. ||:|:.|:....|:..::....:|..::......|.....|:.||::.|:|:..|  .
 Worm   133 LAYNSALYPNFSVAMTSPRGLLAVSVIVDIGKTTSVELRRLTVASQSINYKGQTTNLTDFQP--S 195

  Fly   214 YISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND------DHLKNNFR 272
            .:......|.:|.||||.|.|.|.|||:....||.||...|..:..:...:      .::...:|
 Worm   196 ALLPKTSHYVTYEGSLTFPGCHETVTWVILNNPIYITNDDLQIWNEMQKTETKQPEPSYMTPAYR 260

  Fly   273 PIQPLNDRTLYKNYIEIPIHNMGS 296
            |::.||.|.:..|.      |:||
 Worm   261 PLKSLNGRLVRTNI------NVGS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 72/267 (27%)
cah-2NP_495567.3 alpha_CARP_X_XI_like 16..275 CDD:239395 74/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.