DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Ptprg

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:274 Identity:99/274 - (36%)
Similarity:139/274 - (50%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGYEGRHGPEHWSEDYARCSGKHQSPINI-DQVSAVEKKFPKLEFFNFKVVPDN-LQMTNNGHTV 90
            :.|.|.:|||||......|.|.|||||:| |..:.|.:::.:|:...|.....| ..|.|.|.||
  Rat    60 WAYSGAYGPEHWVTSSVSCGGSHQSPIDILDHHARVGEEYQELQLDGFDNESSNKTWMKNTGKTV 124

  Fly    91 --LVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWG-ENDTIGSEDLINNRAYPAELHVVLR 152
              |:|..|      .|.|..|    |..::.|:..|||| .|.:.|||..:|.|.:|.|:.:...
  Rat   125 AILLKDDY------FVSGAGL----PGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFY 179

  Fly   153 NL-EYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYIS 216
            |. ::..|.:|:.::..|..||.||||..:.....:...:.|..:....|. ...:|..|.:.:.
  Rat   180 NPDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKE-TFLDPFVLRDLLP 243

  Fly   217 KSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLL--TANDDH------LKNNFRP 273
            .|:.||:.||||||||||||.|.||.|..|:.|:..||.||..:  |...||      |:|||||
  Rat   244 ASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRP 308

  Fly   274 IQPLNDRTLYKNYI 287
            .|.||||.:.|:.:
  Rat   309 QQALNDRVVSKSAV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 97/266 (36%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 96/262 (37%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.