DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Car3

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_031632.2 Gene:Car3 / 12350 MGIID:88270 Length:260 Species:Mus musculus


Alignment Length:269 Identity:87/269 - (32%)
Similarity:138/269 - (51%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQ-MTNNG 87
            :|:::||...:||:||.|.|....|.:||||.:.....  |..|.|:.::....|.:.: :.|||
Mouse     1 MAKEWGYASHNGPDHWHELYPIAKGDNQSPIELHTKDI--KHDPSLQPWSASYDPGSAKTILNNG 63

  Fly    88 HTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLR 152
            .|..|......|. ..:|||||:..    |:..|||.|||.:|..|||..::...|.||||:|..
Mouse    64 KTCRVVFDDTYDR-SMLRGGPLSGP----YRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHW 123

  Fly   153 NLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISK 217
            |.:|..|..||.:..||||:..|.::| :..|.::...:.|.:|..|||....|:..|  ..:..
Mouse   124 NPKYNTFGEALKQPDGIAVVGIFLKIG-REKGEFQILLDALDKIKTKGKEAPFTHFDP--SCLFP 185

  Fly   218 SVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDH-----LKNNFRPIQPL 277
            :...|::|.||.|||||.|.:.|:....|:.::..|:...|.|.::.::     |..|:||.||:
Mouse   186 ACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAENEPPVPLVGNWRPPQPV 250

  Fly   278 NDRTLYKNY 286
            ..|.:..::
Mouse   251 KGRVVRASF 259

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 85/258 (33%)
Car3NP_031632.2 alpha_CA_I_II_III_XIII 1..259 CDD:239393 87/267 (33%)
Involved in proton transfer. /evidence=ECO:0000250 64..67 1/2 (50%)