DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Car2

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001344263.1 Gene:Car2 / 12349 MGIID:88269 Length:260 Species:Mus musculus


Alignment Length:270 Identity:92/270 - (34%)
Similarity:146/270 - (54%) Gaps:18/270 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLE--FFNFKVVPDNLQMTNN 86
            ::..:||...:|||:|.:|:...:|..|||::||  :|..:..|.|:  ..::...... .:.||
Mouse     1 MSHHWGYSKHNGPENWHKDFPIANGDRQSPVDID--TATAQHDPALQPLLISYDKAASK-SIVNN 62

  Fly    87 GHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVL 151
            ||:..|:...::|. ..::||||::    .|:..|||||||.:|..|||..:|.:.|.||||:|.
Mouse    63 GHSFNVEFDDSQDN-AVLKGGPLSD----SYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVH 122

  Fly   152 RNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYIS 216
            .|.:|.||..|:.:..|:||:..|.::|..|. |.:.....|..|..|||.....|..|..  :.
Mouse   123 WNTKYGDFGKAVQQPDGLAVLGIFLKIGPASQ-GLQKVLEALHSIKTKGKRAAFANFDPCS--LL 184

  Fly   217 KSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAN-----DDHLKNNFRPIQP 276
            .....|::|.|||||||..|.||||....||.::.:|::.||.|..|     ::.:.:|:||.||
Mouse   185 PGNLDYWTYPGSLTTPPLLECVTWIVLREPITVSSEQMSHFRTLNFNEEGDAEEAMVDNWRPAQP 249

  Fly   277 LNDRTLYKNY 286
            |.:|.:..::
Mouse   250 LKNRKIKASF 259

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 91/259 (35%)
Car2NP_001344263.1 alpha_CA 1..259 CDD:320708 92/268 (34%)