DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Car11

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:274 Identity:78/274 - (28%)
Similarity:124/274 - (45%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPEHW---SEDYARCS-GKHQSPINIDQVSAVEKKF-PKLEFFNFKVVPDNLQMT--NNG-HTVL 91
            ||..|   :..::.|: ||.|||::::....:...| |.|   ......:.|:.|  |.| |...
Mouse    48 GPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPL---RLSTGGEKLRGTLYNTGRHVSF 109

  Fly    92 VKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE- 155
            :..|   ..:.:|.||||.    ..::..:....:|..|..|||..||:..:.||:.::..|.| 
Mouse   110 LPAS---RPVVNVSGGPLL----YSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLIHFNQEL 167

  Fly   156 YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTN--LLSQIDRKGK-------SVNMTNPLPL 211
            |.:.::|....:|:|:::.|..|...|........|  .:::|..|..       |:.:..|...
Mouse   168 YGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESF 232

  Fly   212 GEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAND-----DHLKNNF 271
            |         :.:|.|||:||||||.||||.....::||..|:::.|||:.|.     ..|..|.
Mouse   233 G---------FITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNG 288

  Fly   272 RPIQPLNDRTLYKN 285
            ||:|||..|.|..|
Mouse   289 RPLQPLAHRALRGN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 75/268 (28%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 78/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.