DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and si:ch211-173d10.4

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_021336146.1 Gene:si:ch211-173d10.4 / 108191769 ZFINID:ZDB-GENE-121214-331 Length:234 Species:Danio rerio


Alignment Length:206 Identity:79/206 - (38%)
Similarity:109/206 - (52%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGEND---TIGSEDLINNRAYP 144
            :.||||||..|:...   :..|:||.|..|    |...|||||||..|   ..|||..:|...:|
Zfish     4 LRNNGHTVECKLKAG---VVGVQGGGLKHK----YTVLQFHFHWGGRDPRQQPGSEHSLNRHRWP 61

  Fly   145 AELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGG-YEGFTNLLSQIDRKGKSVNMTNP 208
            .|:|:|.|..:..|.|::...| |.|||.||....:..|.. :|.|...|.:|.|||.:|.:|:.
Zfish    62 VEMHIVSRRTDLNDSAASRVPD-GFAVMGFFIDGKENVTSQVWENFMEYLQKIPRKGDTVRITDD 125

  Fly   209 LPLGEYIS-KSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDDHLKNNFR 272
            :.|.:.:: ..:..|:.|:||||||||.|.|.|..|..||.|:..||  .|..|.:..::   :|
Zfish   126 ISLQQLLTGVDLSRYYRYSGSLTTPPCDEAVQWTVFKDPIIISTDQL--LRFQTVSFGYV---YR 185

  Fly   273 PIQPLNDRTLY 283
            |.|.||.||:|
Zfish   186 PQQSLNKRTVY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 76/202 (38%)
si:ch211-173d10.4XP_021336146.1 alpha_CA 1..196 CDD:320708 78/204 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4275
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.