DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca9

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_031750918.1 Gene:ca9 / 100498132 XenbaseID:XB-GENE-6033533 Length:392 Species:Xenopus tropicalis


Alignment Length:275 Identity:84/275 - (30%)
Similarity:129/275 - (46%) Gaps:32/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EGRHGPEH------------WSEDYARCSGKHQSPIN-IDQVSAVEKKFPKLEFFNFKVVPD-NL 81
            |..|.|.|            |..||..|.|..||||| :...:..:.....:....:.|.|. .|
 Frog    33 EDAHPPGHKSHHWNYQDIHQWDSDYPHCGGPEQSPINVVTSATTFDSNLRPILLSGYNVPPSRTL 97

  Fly    82 QMTNNGHTVLVKMSYNEDEIPS---VRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAY 143
            .:.||||||::       ::|.   :.||     .|..|:..|.|||||..|..|||..:|.:.:
 Frog    98 SLENNGHTVVL-------DLPDSLLIIGG-----LPQTYRATQLHFHWGSQDDPGSEHTVNGQRF 150

  Fly   144 PAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNP 208
            |.|:|||..:.||.....|.....|:||:..|.|.|::....::.....|..|..:|:|:.:.. 
 Frog   151 PGEMHVVHYSAEYSSATEASTHPGGLAVLGVFIQEGEEENPAFQNLLPYLQNITEEGESIEIPG- 214

  Fly   209 LPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR-LLTANDDH-LKNNF 271
            ..:...:.:.::.|:.|.||||||||.:.|.|..|...|.::.:|::... .:.|:.|| |:|||
 Frog   215 FDIRGLLPQRLDRYYHYDGSLTTPPCYQTVNWTLFNQTILLSPEQMDLLEDTIHADHDHILQNNF 279

  Fly   272 RPIQPLNDRTLYKNY 286
            |..|.||.|.:..::
 Frog   280 RAPQSLNGRLVLSSF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 83/268 (31%)
ca9XP_031750918.1 alpha_CA 52..294 CDD:412109 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49534
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.