DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca3

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_002939197.2 Gene:ca3 / 100496328 XenbaseID:XB-GENE-1007186 Length:262 Species:Xenopus tropicalis


Alignment Length:266 Identity:81/266 - (30%)
Similarity:133/266 - (50%) Gaps:16/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPD-NLQMTNNGHTV 90
            |:||...:||:.|:|.:....|..||||.:  ::...|..|.|..:.....|. :|.:.|:|.|.
 Frog     6 DWGYASHNGPDTWAEYFPAAKGDQQSPIEL--LTRYIKHDPTLRPWTSTYHPSTSLTVVNDGTTC 68

  Fly    91 LVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE 155
            .|....:.|: ..::.||:...    |:..|..||||.:|..|||.:|:...|..|:|.:..|.:
 Frog    69 RVVFDDSTDK-SVIKDGPMNGT----YRLRQLQFHWGSSDDHGSEHVIDGFRYAGEMHFIHWNSK 128

  Fly   156 YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVE 220
            |.:...|.....|:|::|.|.::| |:....:.....|..|..|||..:.|:..|  ..:..|..
 Frog   129 YDNITEAKKHPDGVAIIAVFLKIG-KAKPHLKLVLEALDCIKNKGKKAHFTDFDP--TILFPSSR 190

  Fly   221 SYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTAN-----DDHLKNNFRPIQPLNDR 280
            .|::|.||.|||||.|.|||:..:.||.::.:|:..||.:.:.     :.|:.:||||.||:..|
 Frog   191 DYWTYQGSFTTPPCEECVTWLLLSEPITVSPEQMEKFRSVYSTLEGEIECHMVDNFRPPQPVKGR 255

  Fly   281 TLYKNY 286
            .:..::
 Frog   256 EIRASF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 79/258 (31%)
ca3XP_002939197.2 alpha_CA 4..261 CDD:412109 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.