DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and LOC100496280

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_002940642.4 Gene:LOC100496280 / 100496280 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:284 Identity:91/284 - (32%)
Similarity:134/284 - (47%) Gaps:33/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LICASLVL------AQDFGY-EGRHGPEHW-SEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFN 73
            ||...|:|      |.::.| :...||..| ::.:  |:|..||||||  |.|..:....|..|.
 Frog     4 LITVHLILLGLDPIAAEWCYTDPACGPSTWVTQGF--CNGSRQSPINI--VDASVQYNASLGTFT 64

  Fly    74 FKVVPDN--LQMTNN-GHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSE 135
            |....|:  |.:.|| ||||.|:::..    .::.||.|    |..|....||||||.....|||
 Frog    65 FTNYGDSSKLVLLNNPGHTVEVQLASG----VTLSGGGL----PSTYSAVAFHFHWGNTSQNGSE 121

  Fly   136 DLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKG 200
            ..:..|.:|.|:|:| ......:..:|....:||||:.||..|| .|:.......:||..:...|
 Frog   122 HQLGGRQFPMEMHIV-HTKNGMNLTAAKQDPNGIAVLGFFIDVG-TSSSKLPTLASLLVNVSNAG 184

  Fly   201 KSVNMTNPLPLGEYISKSVE--SYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQL-----NAFR 258
            .::.:.....: :.|..:|:  ||:.|.||||||.|.|.|.|..|..||.:....:     |.:.
 Frog   185 TNITLNGSFSI-DSILGAVDRTSYYRYLGSLTTPTCDEAVVWTVFRNPILVPASVIQNFSSNIYL 248

  Fly   259 LLTANDDHLKNNFRPIQPLNDRTL 282
            ..|.:..::.||||.:|.||.|.:
 Frog   249 NSTGSPQNMVNNFRILQQLNSRVV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 85/264 (32%)
LOC100496280XP_002940642.4 alpha_CA 41..272 CDD:412109 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.