DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca10

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_031750638.1 Gene:ca10 / 100493207 XenbaseID:XB-GENE-949649 Length:328 Species:Xenopus tropicalis


Alignment Length:318 Identity:84/318 - (26%)
Similarity:141/318 - (44%) Gaps:66/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FAIVIAPILICASLVLAQDFGYEGRHG---------------PEHW---SEDYARCS-GKHQSPI 54
            |.|:.|.:::|.|   ||....:...|               |..|   :..:..|: ||.|||:
 Frog     8 FFILQASLIVCMS---AQQNSPKIHEGWWTYKEVVQGSFVPVPSFWGLVNSAWNLCAVGKRQSPV 69

  Fly    55 NIDQVSAVEKKFPKLEFFNFKVVPDNLQ---------MTNNGHTVLVKMSYNEDEIPSVRGGPLA 110
            ||:....:...|         :.|..:.         |.|.|..|.:::  :::.:.::.||||.
 Frog    70 NIETSHMIFDPF---------LTPLRINTGGRKVSGTMYNTGRHVSLRL--DKEHLVNISGGPLT 123

  Fly   111 EKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLE-YPDFASALDKDHGIAVMAF 174
                ..::.|:...|:|..|..|||.|:|.:|:..|:.::..|.| |.:...|....:|:.|::.
 Frog   124 ----YSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLIHYNHELYTNVTDAAKSPNGLVVISI 184

  Fly   175 FFQVGDKSTGGYEGFTN--LLSQIDRKG-----KSVNMTNPLPLGEYISKSVESYFSYTGSLTTP 232
            |.:|.|.|........|  .:::|..|.     :.:|:       |.|.....|:.:|.||:|.|
 Frog   185 FIKVTDSSNLFLNRMLNRDTITRITYKNDAYLLQGLNI-------EEIYPETSSFITYDGSMTIP 242

  Fly   233 PCSEEVTWIDFTTPIDITEKQLNAFRLLTAND-----DHLKNNFRPIQPLNDRTLYKN 285
            ||.|..:||....||.||..|:::.|||:.|.     ..:.:||||:|.||:|.:..|
 Frog   243 PCYETASWIIMNKPIYITRMQMHSLRLLSQNQPSQIFSSMSDNFRPVQSLNNRCIRTN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 75/293 (26%)
ca10XP_031750638.1 alpha_CARP_X_XI_like 46..302 CDD:239395 76/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.