DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and Car10

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_017453181.1 Gene:Car10 / 100360015 RGDID:2322930 Length:328 Species:Rattus norvegicus


Alignment Length:276 Identity:75/276 - (27%)
Similarity:130/276 - (47%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PEHW---SEDYARCS-GKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQ---------MTNNG 87
            |..|   :..:..|| ||.|||:||:....:...|         :.|..:.         |.|.|
  Rat    47 PSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPF---------LTPLRINTGGRKVSGTMYNTG 102

  Fly    88 HTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLR 152
            ..|.:::  :::.:.::.|||:.    ..::.|:...|:|..|:.|||.|:|.:|:..|:.::..
  Rat   103 RHVSLRL--DKEHLVNISGGPMT----YSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHY 161

  Fly   153 NLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTN--LLSQIDRKG-----KSVNMTNPL 209
            |.| |.:...|....:|:.|::.|.:|.|.|........|  .:::|..|.     :.:|:    
  Rat   162 NHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNI---- 222

  Fly   210 PLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLLTANDD-----HLKN 269
               |.:.....|:.:|.||:|.|||.|..:||....|:.||..|:::.|||:.|..     .:.:
  Rat   223 ---EELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSD 284

  Fly   270 NFRPIQPLNDRTLYKN 285
            ||||:||||:|.:..|
  Rat   285 NFRPVQPLNNRCIRTN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 73/270 (27%)
Car10XP_017453181.1 alpha_CARP_X_XI_like 46..302 CDD:239395 75/276 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.