DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca14

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001103521.1 Gene:ca14 / 100126213 XenbaseID:XB-GENE-855636 Length:343 Species:Xenopus tropicalis


Alignment Length:300 Identity:100/300 - (33%)
Similarity:147/300 - (49%) Gaps:51/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LICASLVL---------AQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAV--EKKFPKLE 70
            ::|.||::         ..::.|.|.||.|:|...|..|.|..|||||| |.|.:  ::..|.:|
 Frog     1 MLCLSLLILSISHVTVRGSEWTYAGHHGQENWPVTYPDCGGTAQSPINI-QTSNISYDESLPPIE 64

  Fly    71 FFNFKVVPDN--LQMTNNGHTVLVKMSYNEDEIPS---VRGGPLAEKTPLGYQFEQFHFHWGE-N 129
            ...:. .|.|  ..:|||||:|       |..:||   :||      .|..::..|.|.|||. .
 Frog    65 PEGYN-TPGNQPFTLTNNGHSV-------ELSLPSSMTLRG------LPNTFKAAQLHLHWGSPA 115

  Fly   130 DTIGSEDLINNRAYPAELHVVLRNLE-YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLL 193
            ...|||..::...:|||||:|..|.: |.|.:.|.:|..|:||:..||::|......|....:.|
 Frog   116 KQAGSEHRLDGEEFPAELHIVHYNSDKYADISEAKNKPDGLAVLGVFFEIGATDNPAYANILHHL 180

  Fly   194 SQIDRKGKSV-----NMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQ 253
            ..|..|.::|     |:.:.||      :::|.||.|.||||||||.:.|.|..|..|::|:..|
 Frog   181 DNIRYKDQTVSVPSFNVRHLLP------ENLEEYFRYQGSLTTPPCYQSVLWTVFYHPVEISRSQ 239

  Fly   254 LNAFRL----LTAND---DHLKNNFRPIQPLNDRTLYKNY 286
            |...:.    .||.:   :.|.||.|..|.||.||:|.::
 Frog   240 LEKLQTTLYSTTATEVPPEVLGNNVREAQLLNSRTVYSSF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 94/273 (34%)
ca14NP_001103521.1 alpha_CA 28..279 CDD:294017 94/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4504
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm49534
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.