DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH2 and ca6

DIOPT Version :9

Sequence 1:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:264 Identity:91/264 - (34%)
Similarity:141/264 - (53%) Gaps:16/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YEGRHGPEHWSEDYARCSGKHQSPINIDQVSA-VEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVK 93
            |.|....:||:|.|..|.|:.||||:|.:... ...:..:||...::.:..:..|.||||:|   
Zfish    28 YSGELDQKHWAEKYHDCGGQQQSPIDIQRRKVRYSPRMQQLELTGYEDIRGSFLMKNNGHSV--- 89

  Fly    94 MSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWG--ENDTIGSEDLINNRAYPAELHVVLRNLE- 155
                |.::||..  .:.:..|..|...|.|.|||  :.:..|||..::...|.||||||..|.| 
Zfish    90 ----EIQLPSTM--KITKGFPHQYTAVQMHLHWGGWDLEASGSEHTMDGIRYMAELHVVHYNSEK 148

  Fly   156 YPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVE 220
            ||.|..|.:|..|:||:||||:.|......|..|.:.|:.|...|:|::::| |.:...:|:::.
Zfish   149 YPSFEEAKNKPDGLAVLAFFFEDGHFENTYYSDFISNLANIKYVGQSMSISN-LNVLSMLSENLS 212

  Fly   221 SYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFR--LLTANDDHLKNNFRPIQPLNDRTLY 283
            .::.|.||||||||.|.|.|..|.|||.::..|:....  |:..::..|.|::|..||||:|.:.
Zfish   213 HFYRYKGSLTTPPCFESVMWTVFDTPITLSHNQIRKLESTLMDHDNKTLWNDYRMAQPLNERVVE 277

  Fly   284 KNYI 287
            ..::
Zfish   278 STFL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 90/256 (35%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 89/257 (35%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.