DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and SSTR5

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001044.1 Gene:SSTR5 / 6755 HGNCID:11334 Length:364 Species:Homo sapiens


Alignment Length:331 Identity:79/331 - (23%)
Similarity:138/331 - (41%) Gaps:48/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIY 174
            |...:..:::..||.|:...|..||..||::......::|..||.::|||:.|.|.::..|....
Human    34 PSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLAT 98

  Fly   175 NNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLR----RCSRLRSYLI 235
            .|.......|.:.|||...:.|::...::..||.:::|||..|||||...|    |.::|.|...
Human    99 QNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAA 163

  Fly   236 ILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFF----VAAYCIPLT 296
            .:|..|.|     :|.|   :...|.||  .||:..:   ..|..::.|:|.    |..:..||.
Human   164 WVLSLCMS-----LPLL---VFADVQEG--GTCNASW---PEPVGLWGAVFIIYTAVLGFFAPLL 215

  Fly   297 SIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHI 361
            .|...|..|: |...|:.::....:.::|:|:..:|..::.::...|.|:..|          :|
Human   216 VICLCYLLIV-VKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTV----------NI 269

  Fly   362 TPLGSMIP------------ALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRSS 414
            ..|...:|            .:.....:|.:|.||......||...:.:.    .||:.|..:.:
Human   270 VNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVL----CLRKGSGAKDA 330

  Fly   415 YMTRSR 420
            ..|..|
Human   331 DATEPR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 38/125 (30%)
7tm_1 133..384 CDD:278431 65/270 (24%)
SSTR5NP_001044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
7tm_4 54..319 CDD:304433 70/288 (24%)
7tm_1 57..304 CDD:278431 65/270 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..364 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.