DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Ltb4r

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_067688.1 Gene:Ltb4r / 59264 RGDID:620410 Length:351 Species:Rattus norvegicus


Alignment Length:340 Identity:82/340 - (24%)
Similarity:142/340 - (41%) Gaps:74/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIY 174
            |...|..|:...|..:..|||..||:||::....|...|:...:||:|||:.|..:|:..|..::
  Rat    14 PGGMSLSLLPIVLLSVALVVGLPGNSFVVWSILKRMQKRSVTALLVLNLALADLAVLLTAPFFLH 78

  Fly   175 NNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLI 239
            ...:...:.....|||..:|.|:|...::..:|.::|||...|..|....:..::..:..::..|
  Rat    79 FLARGTWSFEVTGCRLCHYVCGVSMYASVLLITIMSLDRSLAVARPFVSQKVRTKAFARWVLAGI 143

  Fly   240 WCYSFLFAVMPALDIGLSVY---VPEGFLTTCSFDYLNKEMPA---RIFMALF-FVAAYCIPLTS 297
            |..|||.|: |.|     ||   .|:.....|...|     |:   ::|..|| .:..:.:|..:
  Rat   144 WVVSFLLAI-PVL-----VYRTVTPKNKTLICDSRY-----PSDGHKVFHLLFEAITGFLLPFLA 197

  Fly   298 IVYSYFYILKVVFTASRIQSNKDK--AKTEQKLAFIVAAIIGLWFLAWSPYAIVAMM----GVFG 356
            :|.||..|      ..|:|:.:.:  .:|.:.:..|:.|....|.    ||.:|.::    .:.|
  Rat   198 VVASYSDI------GRRLQARRFRRSRRTGRLVVLIILAFAAFWL----PYHLVNLVEAGRTLAG 252

  Fly   357 LERHITPLGS--------MIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLR------- 406
            .::: :|.|.        :|...|..::  |:|.|||..             |.|:||       
  Rat   253 WDKN-SPAGQRLKLARYVLIALAFLSSS--VNPVLYACA-------------GGGLLRSAGVGFV 301

  Fly   407 ---------RVSTTR 412
                     .||:||
  Rat   302 VKLLEGTGSEVSSTR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 34/121 (28%)
7tm_1 133..384 CDD:278431 64/271 (24%)
Ltb4rNP_067688.1 7tm_1 37..285 CDD:278431 64/271 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..351 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.