DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and sstr1a

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_696666.1 Gene:sstr1a / 568254 ZFINID:ZDB-GENE-090429-1 Length:366 Species:Danio rerio


Alignment Length:288 Identity:76/288 - (26%)
Similarity:147/288 - (51%) Gaps:21/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 STFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIK 178
            |:.:.::.:|.::.:||..||:.||::......::|..||.::||||.|.|:::..|..:.:::.
Zfish    31 SSAIFISFIYSVVCLVGLCGNSMVIYVIFRYAKMKTATNIYILNLAIADELLMLSVPFLVTSSLL 95

  Fly   179 EGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYS 243
            .....|.:.|||...|..::...:|..||.:::|||..||||::..|......:.::.|.:|.:|
Zfish    96 HHWPFGSLLCRLVLSVDAINMFTSIYCLTVLSIDRYISVVHPIKAARYRRPTIAKMVNLAVWMFS 160

  Fly   244 FLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEM--PARIFMALF----FVAAYCIPLTSIVYSY 302
            .| .::|.:....:....:|.: .|     |.:|  |.|.:||:|    |:..:..|:.:|...|
Zfish   161 IL-VILPIIIFSTTAPNSDGSV-AC-----NMQMPEPERQWMAVFVIYAFLMGFLFPVIAICMCY 218

  Fly   303 FYI---LKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPL 364
            ..|   ::||...:..|..|   |:|:|:..:|..::.::.:.|.|:.||.::.|| :::|...|
Zfish   219 ILIIVKMRVVALKAGWQQRK---KSERKITLMVMMVVTVFVICWMPFHIVQLVSVF-VQQHNATL 279

  Fly   365 GSMIPALFCKTAACVDPYLYAATHPRFR 392
             |.:..:.....:|.:|.||......||
Zfish   280 -SQLAVILGYANSCANPILYGFLSDNFR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 36/121 (30%)
7tm_1 133..384 CDD:278431 68/259 (26%)
sstr1aXP_696666.1 7tm_4 42..>243 CDD:304433 57/210 (27%)
7tm_1 50..298 CDD:278431 68/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.