DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and sstr2b

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_017210358.1 Gene:sstr2b / 560530 ZFINID:ZDB-GENE-130530-727 Length:373 Species:Danio rerio


Alignment Length:327 Identity:82/327 - (25%)
Similarity:149/327 - (45%) Gaps:24/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 STGLSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPK---SSTFLIMAALYCLISVVGCVGNA 135
            ||.||.||.|...::..::..           .:.||.:   ::...::..:|.|:.|||..|||
Zfish    14 STNLSGYSLYDGLLNISEEET-----------QRNEPEQHLTNTNTAVVTVMYFLVCVVGLCGNA 67

  Fly   136 FVIFMFANRKSLRTPANILVMNLAICDFLMLIKCP-IAIYNNIKEGPALGDIACRLYGFVGGLSG 199
            .||::......::|..||.::|||:.|.|.::..| |||...:...| .|...|.:...:..|:.
Zfish    68 LVIYVILRYAKMKTVTNIYILNLAVADILFMLSLPFIAIQLAMVHWP-FGATMCHVVITIDSLNQ 131

  Fly   200 TCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGF 264
            ..:|..|..:::|||..||||::.::......:....:.:|..| |..::|.:.....:...||.
Zfish   132 FTSIFCLMVMSIDRYLAVVHPMKSIKWRKPQVAKATNVAVWVVS-LLVILPVVFYSGLITKAEGC 195

  Fly   265 LTTCSFDYLNKEMPAR-IFMALFFVAAYCIPLTSIVYSY-FYILKVVFTASRIQSNKDKAKTEQK 327
            .  ||..:.:.:...: .||...|:..:.:||..|...| ..|:||..:..::.|:| :..:|:|
Zfish   196 F--CSIVWPDPQGAYQTAFMIYTFLLGFFLPLMVICLCYLLIIIKVKSSGIKVSSSK-RRYSEKK 257

  Fly   328 LAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPLGSMIP--ALFCKTAACVDPYLYAATHPR 390
            :..:|:.::.::...|.|:.|..|..|.|.......|.|:..  .:.....:|.:|.|||.....
Zfish   258 VTRLVSVVVLVFVFCWLPFYIFNMTSVTGTISDTPFLRSVFAFVVVLGYANSCANPILYAFLSEN 322

  Fly   391 FR 392
            ||
Zfish   323 FR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 37/122 (30%)
7tm_1 133..384 CDD:278431 63/255 (25%)
sstr2bXP_017210358.1 7tm_4 59..331 CDD:304433 71/271 (26%)
7tm_1 65..316 CDD:278431 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.