DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and uts2r

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_009305031.1 Gene:uts2r / 559133 -ID:- Length:380 Species:Danio rerio


Alignment Length:337 Identity:84/337 - (24%)
Similarity:155/337 - (45%) Gaps:50/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SSTFLI--MAALYCLISVVGCVGNAFVIFMFANRKSLRTPAN--ILVMNLAICDFLMLIKCPIAI 173
            ::||.|  :.:|.||   ||..||.:.:.:..:  |:|:.|:  |.::|||:.|.|.|:..|..:
Zfish    50 AATFTIGTILSLMCL---VGVSGNIYTLVVMCH--SMRSAASMYIYIINLAMADLLYLLTIPFVV 109

  Fly   174 YNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILL 238
            ..:..:|...|||.||:...:..|:...:|.|||.::.:||..|:.||..::|....|. .|.||
Zfish   110 CTHFLKGWYFGDIGCRILISMDFLTMHASIFTLTVMSTERYFAVLKPLDTVKRSKSYRK-AIALL 173

  Fly   239 IWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLN---KEMPARIFMALFFVAAYCIPLTSIVY 300
            :|..|.:..:...:.:.|        :|..|....|   ..:..:|:::..|..:...|  .::.
Zfish   174 VWTASLILTLPMIISVQL--------MTMNSKQMCNPTLSPLSYKIYISFLFGTSIVAP--GVII 228

  Fly   301 SYFYI-LKVVFTASRIQSNKDKAK-TEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVF-------- 355
            .|.|| |...:..|:.::.|...| ..||:.:::..|:.|::..:.|:.|..::..|        
Zfish   229 GYLYIRLARTYWISQTETFKQTKKLPNQKVLYLIFTIVLLFWACFLPFWIWQLLNQFQPTLDLST 293

  Fly   356 GLERHITPLGSMIPALFCKT--AACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRSSYMTR 418
            ..:|:|..|.:      |.|  .:|::|:||......::..:|.        |:.:.|..||:.|
Zfish   294 KAKRNINYLTT------CLTYSNSCINPFLYTLLTKNYKEYLRK--------RQRTWTAGSYLNR 344

  Fly   419 SRSSFTHRLRTS 430
             |:.|....|.|
Zfish   345 -RNRFQRSPRRS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 39/123 (32%)
7tm_1 133..384 CDD:278431 64/267 (24%)
uts2rXP_009305031.1 7tm_1 69..318 CDD:278431 64/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.