DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and sstr1b

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_005172275.1 Gene:sstr1b / 557645 ZFINID:ZDB-GENE-120410-2 Length:371 Species:Danio rerio


Alignment Length:364 Identity:88/364 - (24%)
Similarity:163/364 - (44%) Gaps:55/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LSNYSNYPSYIHYRDKYDLSYIAKVNPF-------WLQFEPPKSSTFLIMAALYCLISVVGCVGN 134
            |:.|:...|::          :|...||       :.:.||..|.  :|:.::|.|:..:|..||
Zfish     4 LAGYNGNESFM----------LATDLPFNSTGDYEYYESEPDASK--IIIPSIYALVCCIGVTGN 56

  Fly   135 AFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCP-IAIYNNIKEGPALGDIACRLYGFVGGLS 198
            |.||::......::|..||.::||||.|.|.::..| :|....:...| .|.:.|||...|.|::
Zfish    57 AMVIYVILKYAKMKTATNIYILNLAIADELFMLSVPFLATSAAVHHWP-FGSLMCRLVLSVDGIN 120

  Fly   199 GTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEG 263
            ...:|..||.:::|||..||||::..|......:.::.:.:|..| |..::|.:....:|...:|
Zfish   121 MFTSIFCLTVLSVDRYIAVVHPIKAARYRRPTVAKVVNVCVWGLS-LLVILPIIIFADTVPAQDG 184

  Fly   264 FLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYIL----KVVFTASRIQSNKDKAKT 324
            .: .|:|.:..... :..|:...|:..:.:|:.:|...|..|:    .|...|..:|    :.::
Zfish   185 GV-DCNFMWPESSW-SEAFVVYTFLLGFLLPVGAICLCYCLIVVRMRAVGLKAGWLQ----RRRS 243

  Fly   325 EQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPLGSMIPALFCKTA---ACVDPYLYAA 386
            |:|:..:|..::.::.|.|.|:.||.::.||.     .|...|:..||...:   :..:|.||..
Zfish   244 EKKITRMVLLVVAVFVLCWMPFYIVQLISVFR-----KPPDPMVTQLFVILSYANSGANPILYGF 303

  Fly   387 THPRFR---------------VEVRMLFYGRGVLRRVST 410
            ....||               ::...:.|....|||.:|
Zfish   304 VSDNFRRSFQRIICFRWLENGLDAEQVDYCAVALRRQTT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 39/122 (32%)
7tm_1 133..384 CDD:278431 66/258 (26%)
sstr1bXP_005172275.1 7tm_4 47..>198 CDD:304433 44/154 (29%)
7tm_1 55..301 CDD:278431 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.