DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and OPRL1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001305782.1 Gene:OPRL1 / 4987 HGNCID:8155 Length:399 Species:Homo sapiens


Alignment Length:369 Identity:80/369 - (21%)
Similarity:155/369 - (42%) Gaps:67/369 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HDKHVNDSVSTGLSNYSNYPSYIHYRDKYDLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVV 129
            :..|:..::|....|:|..|.::    ..:.|:.|.: |..|:         :.:..||..:.|.
Human    14 YGSHLQGNLSLLSPNHSLLPPHL----LLNASHGAFL-PLGLK---------VTIVGLYLAVCVG 64

  Fly   130 GCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGPALGDIACRLYGFV 194
            |.:||..|:::......::|..||.:.|||:.|.|:|:..|.       :|.   ||....:.|.
Human    65 GLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPF-------QGT---DILLGFWPFG 119

  Fly   195 GGLSGT-CAIG---------TLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVM 249
            ..|..| .||.         ||||:::|||..:.||::.|...:..::..:.:.||..:.:..|.
Human   120 NALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVP 184

  Fly   250 PAL---------DIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYI 305
            .|:         :|...|.:|      ...||...     :|....|:.::.:|:..|...|..:
Human   185 VAIMGSAQVEDEEIECLVEIP------TPQDYWGP-----VFAICIFLFSFIVPVLVISVCYSLM 238

  Fly   306 LKVVFTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPLGSMIPA 370
            ::.:.....:..:::|.:..:::..:|..::.::...|:|..:..:....|::    |......|
Human   239 IRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQ----PSSETAVA 299

  Fly   371 L--FCKTA-----ACVDPYLYAATHPRFRVEVRMLFYGRGVLRR 407
            :  || ||     :|::|.|||.....|:...|. |.....|||
Human   300 ILRFC-TALGYVNSCLNPILYAFLDENFKACFRK-FCCASALRR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 35/131 (27%)
7tm_1 133..384 CDD:278431 58/276 (21%)
OPRL1NP_001305782.1 7tm_4 66..>188 CDD:304433 35/131 (27%)
7tm_1 68..319 CDD:278431 58/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.