DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Rh2

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster


Alignment Length:329 Identity:117/329 - (35%)
Similarity:178/329 - (54%) Gaps:29/329 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNL 158
            |::::  |||:|.:|.|.......|:......|.::.|.||..|:::|...||||||||:||:||
  Fly    37 DMAHL--VNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNL 99

  Fly   159 AICDFLMLI-KCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQ 222
            |..||.|:. :.|:.|.|...|...||.:.|.:|...|.|.|..:|.::..||.|||||:|..:.
  Fly   100 AFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGIN 164

  Fly   223 --PLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMAL 285
              |:   :...|.:.||.||..:..:.|||.  ||.|.|||||.||.||.||:.:....|.::..
  Fly   165 GTPM---TIKTSIMKILFIWMMAVFWTVMPL--IGWSAYVPEGNLTACSIDYMTRMWNPRSYLIT 224

  Fly   286 FFVAAYCIPLTSIVYSYFYILKVVFT---ASRIQSNKDKAKT-----------EQKLAFIVAAII 336
            :.:..|..||..|.|||::|:..|..   |.|.|:.|...|:           |.|||.:....|
  Fly   225 YSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTI 289

  Fly   337 GLWFLAWSPYAIVAMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVR----M 397
            .|||:||:||.::...|:|.:: .:|||.::..|.|.||:|..:|.:|..:||::|:.::    |
  Fly   290 SLWFMAWTPYLVICYFGLFKID-GLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPM 353

  Fly   398 LFYG 401
            ..:|
  Fly   354 CVFG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 48/124 (39%)
7tm_1 133..384 CDD:278431 101/267 (38%)
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 69/174 (40%)
7tm_1 74..336 CDD:278431 101/267 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D389088at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.