DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and sstr5

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_998462.1 Gene:sstr5 / 406588 ZFINID:ZDB-GENE-040426-2502 Length:383 Species:Danio rerio


Alignment Length:318 Identity:76/318 - (23%)
Similarity:148/318 - (46%) Gaps:26/318 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 MAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGPAL 183
            :|.:|.::.:||..||:..||:......::|..|:.::|||:.|.|.::..|....:|:......
Zfish    37 LAVIYLVVFIVGLTGNSLAIFVVLRYTKMKTVTNMYILNLAVADELYILGLPFLTTHNVLSYWPF 101

  Fly   184 GDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAV 248
            |:..||:..:...:|...:...||.:::|||..||||::..|......:.:|..::|..|.|   
Zfish   102 GNFLCRILMWADSISQFTSTFCLTVMSIDRYMAVVHPIRSARWRRPSVAKVINSMVWALSCL--- 163

  Fly   249 MPALDIGLSVY--VPEGFLTTCSFDYLN-KEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVVF 310
               |.:.:.:|  |..| |.||:..:.. :::.:..|:....:..:..||..|...|..|:..|.
Zfish   164 ---LTLPVIIYCDVQPG-LNTCNLSWPEPRDVWSTAFILYTAILGFFCPLLVICLCYLLIVIKVK 224

  Fly   311 TASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHIT-PLGSMIPALFCK 374
            :||.......:.|:|:|:..:|..|:.::.:.|.|:   .|:.:|.|.  :| |..::|..::..
Zfish   225 SASARAGLSKRRKSEKKVTRMVVIIVVVFVICWLPF---FMLNIFNLV--VTLPENNIITGVYFL 284

  Fly   375 TA------ACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRSSYMTRSRSSFTHR 426
            |.      :|.:|.||......|:...:.:.    .:.||:.....:..|:|.|..|:
Zfish   285 TVILTYVNSCANPLLYGFLSDNFKRSFQKVL----CIHRVNGVSDEHPNRARISRNHQ 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 33/121 (27%)
7tm_1 133..384 CDD:278431 63/260 (24%)
sstr5NP_998462.1 7tm_4 42..>241 CDD:304433 51/205 (25%)
7tm_1 51..300 CDD:278431 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.