DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olr53

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001001008.1 Gene:Olr53 / 405378 RGDID:1333228 Length:314 Species:Rattus norvegicus


Alignment Length:339 Identity:59/339 - (17%)
Similarity:129/339 - (38%) Gaps:84/339 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SSTFLI------------MAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLM 165
            |.|||:            ::..:|.:.:....||:.::|:.....:|:.|....:..|:..|..:
  Rat     9 SPTFLLTGVPGLEWAHPWISIPFCCLYLTALSGNSLILFVVLTEPTLQEPMYYFLSMLSTTDIGL 73

  Fly   166 LIKCPIAI----YNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQ---- 222
            .|...:.:    :.:.:|   :...||....|...|........|.|:|.||:..:.:||:    
  Rat    74 CISTIVTVLGIFWLDTRE---ISFSACLSQMFFIHLFTFMESSVLLAMAFDRFIAISNPLRYAAI 135

  Fly   223 ------------PLRRCSRLRSYLIIL---LIWC------YSFLFAVMPALDIGLSVYVPEGFLT 266
                        .:.|.:.:.:.|::|   |.:|      :|:.|.             |:....
  Rat   136 LTHARIAQIGLAVITRATVILTPLVLLLKRLSFCRSHVLHHSYCFH-------------PDVMKL 187

  Fly   267 TCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAF- 330
            :||...:|.     .|.....::...:....|:.||..|::.|.:.:        :..|:|.|| 
  Rat   188 SCSDTKINS-----AFGLTAIISTAGVDSIFILLSYVLIIRSVLSIA--------SPGERKKAFG 239

  Fly   331 -----IVAAIIGLWFLAWSPYAIVAMMGVFGLERHITP-LGSMIPALFCKTAACVDPYLYAATHP 389
                 |.|  :.::::   |...::.:..||  :|..| :.::|..::......::|.:|:....
  Rat   240 TCISHITA--VAIFYI---PLISLSFVHRFG--KHAPPYVPTLIANVYLLIPPVMNPIIYSVKTK 297

  Fly   390 RFRVEVRMLFYGRG 403
            :.:..:..|.|.:|
  Rat   298 QIQRAILRLVYCKG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 26/150 (17%)
7tm_1 133..384 CDD:278431 50/286 (17%)
Olr53NP_001001008.1 7tm_4 31..306 CDD:304433 52/310 (17%)
7tm_1 41..292 CDD:278431 50/286 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.