DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olr1117

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001000884.1 Gene:Olr1117 / 405183 RGDID:1333879 Length:312 Species:Rattus norvegicus


Alignment Length:325 Identity:75/325 - (23%)
Similarity:125/325 - (38%) Gaps:90/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDF-LMLIKCPIAIYNNIKE 179
            |::..::| ||:|   :||..:|...::...|.||..:.:..|:|.|. ...:..|..:.|....
  Rat    28 FIMFLSMY-LITV---LGNLIIILAISSGSQLHTPMYLFLSILSINDICYSTVTIPKMLVNIQAH 88

  Fly   180 GPALGDIACRLYGFVGGLSGTCAIG--------TLTAIALDRYNVVVHPLQPLRRCSRLRSYLII 236
            ..::..|.|        ||..|.:.        .|..:|.|||..:         |..||..:|:
  Rat    89 DDSISYIEC--------LSQICFVSIFGGMENFLLAVMAYDRYVAI---------CKPLRYTVIM 136

  Fly   237 LLIWC-----YSFLFAVMPALDIGLSVY---------VPEGFL-------TTCSFDYLNKEMPAR 280
            ..|:|     :|..|::|.||...|.|.         :|..|.       ..||..:||.     
  Rat   137 NPIFCALMILFSLFFSIMDALLHSLMVLRLSFCTELEIPHFFCELAQIIKLACSDTFLNN----- 196

  Fly   281 IFMALFFVAAYCI---PLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLA---FIVAAIIGLW 339
               .|.||||:..   |:..||:||.||:..|.   |:.|:..|.:.....|   .:|:...|..
  Rat   197 ---FLIFVAAFVFGGGPVCGIVFSYIYIVSSVL---RMPSSGGKHRAFSTCASHLSVVSLFYGTG 255

  Fly   340 FLAWSPYAI------VAMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRML 398
            |..:...|:      .||..:         :.|::|.|       ::|::|:..:...:..:|.|
  Rat   256 FGVYISSAVTDSLRNTAMASM---------MYSVVPPL-------LNPFIYSLRNREMKKALRTL 304

  Fly   399  398
              Rat   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 31/135 (23%)
7tm_1 133..384 CDD:278431 67/292 (23%)
Olr1117NP_001000884.1 7tm_4 31..301 CDD:304433 72/317 (23%)
7tm_1 41..290 CDD:278431 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.