DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Olr1350

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001000752.1 Gene:Olr1350 / 405022 RGDID:1333489 Length:323 Species:Rattus norvegicus


Alignment Length:295 Identity:61/295 - (20%)
Similarity:115/295 - (38%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKC------PI 171
            :.|..::..::.::.||..:||..:|.:......|.:|....:.||:..|.     |      |.
  Rat    28 AETQALLFTVFLVLYVVTILGNLTMIMVITLDARLHSPMYFFLKNLSFVDL-----CYSSAIAPN 87

  Fly   172 AIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQ-PLRRCSRLRSYLI 235
            |:.|.:.....:...||....|...|..|.....|..:|.||:..:..||: |:..|..:.:.| 
  Rat    88 ALANFLSASKVISFEACATQLFFFSLLATTEAFLLAVMAYDRFMAICSPLRYPVTMCPTVCARL- 151

  Fly   236 ILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMA----------LFFVAA 290
            :|..:|...|.::   :...|:..:|  |.::...|:...::|..:.:|          ||.:..
  Rat   152 VLSTYCGGCLNSI---VQTSLTFRLP--FCSSNRIDHFYCDVPPLLQLACASTALNELFLFGLCG 211

  Fly   291 YCIPLT--SIVYSYFYILKVVFTASRIQSNKDKAK---TEQKLAFIVAAIIGLWFLAWSPYAIVA 350
            :.|..|  :::.||.||   ..|..|:.|...:.|   |.......|:...|..|:.::....||
  Rat   212 FIIVSTTLAVLVSYGYI---TVTILRMHSGSGRHKVFSTCGSHMMAVSLFYGTVFVMYAQPGAVA 273

  Fly   351 MMGVFGLERHITPLGSMIPALFCKTAACVDPYLYA 385
            .|.          .|.:|...:......::|.:|:
  Rat   274 SMA----------QGKVISVFYTLVIPMLNPLIYS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 31/128 (24%)
7tm_1 133..384 CDD:278431 57/272 (21%)
Olr1350NP_001000752.1 7tm_4 38..311 CDD:304433 60/285 (21%)
7tm_1 48..297 CDD:278431 57/272 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.