DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and oprl1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001305986.1 Gene:oprl1 / 402851 ZFINID:ZDB-GENE-040312-4 Length:395 Species:Danio rerio


Alignment Length:377 Identity:80/377 - (21%)
Similarity:162/377 - (42%) Gaps:68/377 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NDSVSTGLSNYSNYPSYIH-YRDKYDLSYIAKVNPFWLQFEPPKSSTF------LIMAALYCLIS 127
            |||:  |.::    |.:.| |.:....:..:..|         :|.:|      :.:|.:|.::.
Zfish     5 NDSI--GFTD----PRHFHLYNESLFQNNFSTFN---------ESDSFFPKGFKITIAVVYMIVC 54

  Fly   128 VVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGP-------ALGD 185
            |||.|||..|:::......::|..||.:.|||:.|.|:|...|.       :|.       ..|:
Zfish    55 VVGLVGNCLVMYVIIRYTKMKTATNIYIFNLALADALVLATLPF-------QGTDVFLGFWPFGN 112

  Fly   186 IACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMP 250
            ..|::...:...:...::.|||.:::|||..|.||::.|...:..::.::.:.:|..:....| |
Zfish   113 ALCKVVVSIDYYNMFTSVFTLTVMSMDRYVAVCHPVKALDMRTPHKAKVVNICVWVLASAIGV-P 176

  Fly   251 ALDIGLSVYVPEGFLTTCSF------DYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVV 309
            |:.:| .|....|....|..      .|.:.     :|....|:.::.||:..|...|..::|.:
Zfish   177 AMVLG-DVEQDNGESIECILVLPDPRSYWDP-----VFGTCVFLLSFLIPVAIISVCYSLMVKRL 235

  Fly   310 FTASRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPLGSMIPALFCK 374
            .:...:..:|:|.:..:::..:|..::..:.:.|:|..|:|:....|.  ::..:.:::...||.
Zfish   236 RSVRILSGSKEKDRNLRRITRMVLVVVAAFVVCWTPIQIMALAQSLGF--NLASVQTVVFMHFCI 298

  Fly   375 TAACV----DPYLYA------------ATHP-RFRVEVRMLFYGRGVLRRVS 409
            ....|    :|.|||            ..|| ||.::.:.....|.:.|.|:
Zfish   299 ALGYVNSSLNPVLYAFLDENFKRCFREFCHPSRFGIDAQQSGRMRHITREVA 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 31/128 (24%)
7tm_1 133..384 CDD:278431 54/267 (20%)
oprl1NP_001305986.1 7tm_1 60..312 CDD:278431 54/267 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.