DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and OR5B2

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001005566.1 Gene:OR5B2 / 390190 HGNCID:8323 Length:309 Species:Homo sapiens


Alignment Length:331 Identity:80/331 - (24%)
Similarity:126/331 - (38%) Gaps:90/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEG 180
            |::...:| |:::.|.:|...:|.|   ...|.||....:.||::.||    ....|:...:..|
Human    26 FILFTFIY-LLTLCGNLGMMLLILM---DSCLHTPMYFFLSNLSLVDF----GYSSAVTPKVMAG 82

  Fly   181 PALGD-------IACRLYGFVGGLSGTCAIGT-----LTAIALDRYNVVVHPLQ-------PLRR 226
            ...||       .|.:::.||       |:.|     |.::|.|||..|..||.       .:..
Human    83 FLRGDKVISYNACAVQMFFFV-------ALATVENYLLASMAYDRYAAVCKPLHYTTTMTASVGA 140

  Fly   227 CSRLRSYL------------IILLIWCYSFL----FAVMPALDIGLSVYVPEGFLTTCSFDYLNK 275
            |..|.||:            |..|.:|.|.|    |..:||: :.||          ||..:.::
Human   141 CLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVPAV-MALS----------CSDKHTSE 194

  Fly   276 EMPARIFMA---LFFVAAYCIPLTSIVYSYFYILKVVFTASRIQSNKDKAKTEQKLAFIVAAIIG 337
            .:  .:||:   :|||      |..|..||.:|.   .|..::.|    ||..||.....|:   
Human   195 VI--LVFMSSFNIFFV------LLVIFISYLFIF---ITILKMHS----AKGHQKALSTCAS--- 241

  Fly   338 LWFLAWSP-YAIVAMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYG 401
             .|.|.|. |..|..:.:.....|......|....:......::|.:|:..:.    ||:..|  
Human   242 -HFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNR----EVQNAF-- 299

  Fly   402 RGVLRR 407
            :.||||
Human   300 KKVLRR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 38/156 (24%)
7tm_1 133..384 CDD:278431 68/289 (24%)
OR5B2NP_001005566.1 7tm_4 29..303 CDD:304433 75/324 (23%)
7tm_1 39..288 CDD:278431 69/292 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.