DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and mchr1b

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_692413.3 Gene:mchr1b / 353180 ZFINID:ZDB-GENE-030502-5 Length:386 Species:Danio rerio


Alignment Length:392 Identity:83/392 - (21%)
Similarity:149/392 - (38%) Gaps:106/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HSHSTG----------STTSTAGSSATESSAVNVGKDHDKHVNDSVSTGLSNYSNYPSYIHYRDK 92
            :|.:||          :.|.:..||...:|:.::.:|:|:           .|.|          
Zfish    15 YSQTTGDYQRKIVMDFNMTPSENSSNEFNSSQHLNRDNDE-----------QYHN---------- 58

  Fly    93 YDLSYIAKVNPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLR---TPANIL 154
                                    ::|.::|.:|..||.:||..||:....:...|   |..:|.
Zfish    59 ------------------------VLMPSIYGVICFVGIIGNCIVIYTIVKKTKFRAQQTVPDIF 99

  Fly   155 VMNLAICDFLMLIKCPIAIYNNIKEGP-ALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVV 218
            :.:|:|.|.|.|:..|..|:..:..|. ..|...|.:...:...|...:...||.:.||||...|
Zfish   100 IFSLSIADLLFLLGMPFLIHQLVGNGSWCFGATMCTVITALDSNSQIVSTYILTVMTLDRYLATV 164

  Fly   219 HPLQPLRRCSRLR----SYLIILLIWCYSFL--------FAVMPALD--IGLSVYVPEGFLTTCS 269
            ||:    |.:.:|    :..::.|:|..|.|        ..:||..|  :|.::.:|        
Zfish   165 HPI----RFNHIRTPRVAVAVVALVWILSLLSITPVWMYAGLMPLRDGSMGCALLLP-------- 217

  Fly   270 FDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILK-VVFTASRIQSNKDKAKTEQKLAFIVA 333
                |.......|....||.|:.:||..|...:|.||: :..|.:.:..:..:.:| :|:..:..
Zfish   218 ----NPATDTYWFTLYQFVLAFALPLVIICVVFFKILQNMAATVAPLPQHSLRVRT-RKVTRMAV 277

  Fly   334 AIIGLWFLAWSPYAIVAMMGVFGLERHITPLGSMIPALFCKTAA--------CVDPYLYAATHPR 390
            ||...:|:.|:|:.|:.:       .|::........||....|        |::|.||......
Zfish   278 AICLAFFICWAPHYILQL-------AHLSVQRPSYAFLFAYNVAISMGYANSCINPLLYIMLSET 335

  Fly   391 FR 392
            |:
Zfish   336 FK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 36/137 (26%)
7tm_1 133..384 CDD:278431 64/277 (23%)
mchr1bXP_692413.3 7tm_4 69..341 CDD:304433 69/293 (24%)
7tm_1 75..329 CDD:278431 64/277 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.