DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and oprd1b

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_997920.2 Gene:oprd1b / 336529 ZFINID:ZDB-GENE-030131-8473 Length:375 Species:Danio rerio


Alignment Length:378 Identity:80/378 - (21%)
Similarity:159/378 - (42%) Gaps:74/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LSNYS-NYPSYIHYRDKYDLSYI---AKVNPFW----LQFEPPKSSTFLIMA----ALYCLISVV 129
            :|::| .||.::|     :.|::   |.:...|    .:.:..:.|:.:.:|    |||.:|.||
Zfish     8 VSDFSERYPLFLH-----NSSFLEEPAGLLSNWSGGSSELKAVRGSSAVAIAVSITALYSVICVV 67

  Fly   130 GCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLMLIKCPIAIYNNIKEGPALGDIACRLYGFV 194
            |.|||..|::.......::|..||.:.|||:.|.|.....|......:......|::.|::...:
Zfish    68 GLVGNVLVMYGVVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMGTWPFGELLCKVVIAI 132

  Fly   195 GGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYS-------FLFAVMPAL 252
            ...:...:|.|||.:::|||..|.||::.|...:.:::.:|.:.:|..|       .:.||...|
Zfish   133 DYYNMFTSIFTLTMMSVDRYIAVCHPVRALDFRTPVKAKIINICVWILSSAVGFPVMVMAVTKEL 197

  Fly   253 DIGLSVYV-----PEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYILKVVFTA 312
            |.|.::.:     ||.:..|             :.....|:.|:..|:..|...|..::..:.:.
Zfish   198 DSGKTICMLKFPDPEWYWDT-------------VTKICVFIFAFVFPVLVITVCYGLMILRLKSV 249

  Fly   313 SRIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSP-YAIVAMMGVFGLER---------HI-TPLGS 366
            ..:..:|:|.:..:::..:|..::..:.:.|:| :..:.:..|..:::         |: ..||.
Zfish   250 RLLSGSKEKDRNLRRITRMVLVVVAAFIICWTPIHIFIIVKTVVEIDQKNLLVVACWHLCIALGY 314

  Fly   367 MIPALFCKTAACVDPYLYAATHPRF-------------RVEVRMLFYGRGVLR 406
            |..:|        :|.|||.....|             |:|.......|.|:|
Zfish   315 MNSSL--------NPVLYAFLDENFKRCFREFCLPFRTRIEQNSFSKARSVIR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 33/128 (26%)
7tm_1 133..384 CDD:278431 53/273 (19%)
oprd1bNP_997920.2 7tm_1 76..324 CDD:278431 50/268 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.