DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and opn1mw1

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_571328.2 Gene:opn1mw1 / 30503 ZFINID:ZDB-GENE-990604-42 Length:349 Species:Danio rerio


Alignment Length:337 Identity:98/337 - (29%)
Similarity:158/337 - (46%) Gaps:29/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RDKYDLS--YIAKVNPFWLQFEPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPAN 152
            |..||.:  |:|         ||.|   |..:|....|:.:.|...|...:.:.|..|.||.|.|
Zfish    21 RSPYDYTQYYLA---------EPWK---FKALAFYMFLLIIFGFPINVLTLVVTAQHKKLRQPLN 73

  Fly   153 ILVMNLAICDFLMLI-KCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNV 216
            .:::|||....:|:| ...::.|.::....|||.:.|.:.||...|.|..|:.:|..:|::||.|
Zfish    74 YILVNLAFAGTIMVIFGFTVSFYCSLVGYMALGPLGCVMEGFFATLGGQVALWSLVVLAIERYIV 138

  Fly   217 VVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDY--LNKEMPA 279
            |..|:... :.|...:...|...|..:...||.|.  .|.|.|:|||..|:|..||  ||.|...
Zfish   139 VCKPMGSF-KFSANHAMAGIAFTWFMACSCAVPPL--FGWSRYLPEGMQTSCGPDYYTLNPEYNN 200

  Fly   280 RIFMALFFVAAYCIPLTSIVYSY-FYILKVVFTASRIQSNKDKAKTEQKLA-FIVAAIIGLWFLA 342
            ..::...|...:|||:|:|.::| ..:..|...|::.|.::...|.|:::. .::..::|..| |
Zfish   201 ESYVMYMFSCHFCIPVTTIFFTYGSLVCTVKAAAAQQQESESTQKAEREVTRMVILMVLGFLF-A 264

  Fly   343 WSPYAIVAMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFR-VEVRMLFYGRGVL- 405
            |.|||..|....|......:.....:||.|.||:|..:|.:|...:.:|| ..:..||.|:..| 
Zfish   265 WVPYASFAAWIFFNRGAAFSAQAMAVPAFFSKTSAVFNPIIYVLLNKQFRSCMLNTLFCGKSPLG 329

  Fly   406 ----RRVSTTRS 413
                ..|||:::
Zfish   330 DDESSSVSTSKT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 34/122 (28%)
7tm_1 133..384 CDD:278431 76/255 (30%)
opn1mw1NP_571328.2 Rhodopsin_N 2..37 CDD:287397 8/27 (30%)
7tm_4 45..>222 CDD:304433 56/179 (31%)
7tm_1 55..306 CDD:278431 76/254 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..349 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.