DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh7 and Opn4

DIOPT Version :9

Sequence 1:NP_524035.2 Gene:Rh7 / 39389 FlyBaseID:FBgn0036260 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_038915.1 Gene:Opn4 / 30044 MGIID:1353425 Length:521 Species:Mus musculus


Alignment Length:339 Identity:110/339 - (32%)
Similarity:184/339 - (54%) Gaps:22/339 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 WLQF---EPPKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLML 166
            |:.|   :.|..:.: .:..:..|:.:.|.:||..||:.|...:.||||||:.::|||:.||||.
Mouse    56 WVPFPTVDVPDHAHY-TLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMS 119

  Fly   167 I-KCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRL 230
            : :.|:...:::.:....|:..|..|.|.|.:.|..::.||||||:|||.|:..||..:.|.|:.
Mouse   120 VTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKR 184

  Fly   231 RSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPL 295
            |:.|::|.:|.|:..:::.|.  .|.|.|||||.||:||:||:......|.:..|.|...:.:||
Mouse   185 RTALVLLGVWLYALAWSLPPF--FGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPL 247

  Fly   296 TSIVYSYFYILKVVFTASRI-----------QSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIV 349
            ..|::.|.:|.:.:....|.           :....:.::|.|:|.:...:|.|:.|:|:||:.|
Mouse   248 LIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTV 312

  Fly   350 AMMGVFGLERHITPLGSMIPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRRVSTTRS- 413
            |::...|....:||..|.:||:..|.:|..:|.:||.|||::||.:.......|||..||..|| 
Mouse   313 ALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSGQRSH 377

  Fly   414 ---SYMTRSRSSFT 424
               ||.:..||:.:
Mouse   378 PSLSYRSTHRSTLS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh7NP_524035.2 7tm_4 125..>247 CDD:304433 46/122 (38%)
7tm_1 133..384 CDD:278431 87/262 (33%)
Opn4NP_038915.1 7tm_4 77..>244 CDD:304433 63/168 (38%)
7tm_1 86..347 CDD:278431 87/262 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.